DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rac1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_599193.1 Gene:Rac1 / 363875 RGDID:619755 Length:192 Species:Rattus norvegicus


Alignment Length:189 Identity:101/189 - (53%)
Similarity:131/189 - (69%) Gaps:10/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLR 100
            :|..:||||.|||||:||:||.|.||.|||||||||::.|:.||.:..||.||||||||||:|||
  Rat     4 IKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLR 68

  Fly   101 PLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNS--EKF---- 159
            |||||.|:.||:|:|:.|..|||||::||:||:||...:.|::|||||||||....  ||.    
  Rat    69 PLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKK 133

  Fly   160 ---VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPKTTS-KQSCKIL 214
               :|..:|..|.|||.|...:||||..::.|:.||:||:|||...|.... |:.|.:|
  Rat   134 LTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 94/170 (55%)
RHO 38..202 CDD:197554 96/172 (56%)
Rac1NP_599193.1 Rac1_like 3..176 CDD:206663 95/171 (56%)
Effector region. /evidence=ECO:0000255 32..40 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.