DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RhoU

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001036266.1 Gene:RhoU / 31945 FlyBaseID:FBgn0083940 Length:582 Species:Drosophila melanogaster


Alignment Length:209 Identity:66/209 - (31%)
Similarity:109/209 - (52%) Gaps:27/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FLLNKDERGKKPGMTANITKS--------------PRP-LKITIVGDGMVGKTCMLITYTRNEFP 61
            |||.|.:..|.....|..|::              |:| :|..:||||.||||.::::|..|.|.
  Fly   354 FLLRKRKSKKTTAAAAATTEAATTAKKDGKKAIAQPQPSIKCVLVGDGAVGKTNLILSYLENRFN 418

  Fly    62 EEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVK 126
            .|:|||..|.:..::.|::...:||:.|||||:..:.||.|.||.::.||||:|:....:|..:|
  Fly   419 PEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRELCYPDSDVFLLCFSVVKPETFRAIK 483

  Fly   127 SKWWPEIRHFSAHVPVVLVGTKLDLRI---------PNSEKFVTTQEGKKMRKEIHAFNLVECSA 182
            :||.|:.....|  .::||||:.|||.         .|.|:.::..:...:...|.| ..:|.|:
  Fly   484 TKWAPKFAKTKA--ALILVGTQADLRTSPNVLNKLQTNGEEAISYADAWDLATTIGA-KYIETSS 545

  Fly   183 KKKQNLQQVFEEAV 196
            ..:..::.||:.|:
  Fly   546 ATQDKVKDVFDTAI 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 57/170 (34%)
RHO 38..202 CDD:197554 56/168 (33%)
RhoUNP_001036266.1 Wrch_1 393..562 CDD:133330 57/170 (34%)
RHO 395..559 CDD:197554 55/166 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24072
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.