DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rhobtb3

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001101115.1 Gene:Rhobtb3 / 309922 RGDID:1311683 Length:611 Species:Rattus norvegicus


Alignment Length:127 Identity:33/127 - (25%)
Similarity:56/127 - (44%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EYIPTVFDN-----HACNIAVDDRDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSF 122
            ||..:.|.|     |.|.:           ||....:.|.....:.  ..:..::.|:::.:.||
  Rat    57 EYQASAFGNVKLVVHDCPV-----------WDIFDSDWYTSRNLIG--GADIIVIKYNVNDKFSF 108

  Fly   123 ENVKSKWWPEIRHFSAHVPVVL--VGTKLDLRIP------NSEK--FVTTQEGKKMRKEIHA 174
            ..||..:.|.|:..|..|||::  |||:.:..:|      .|::  .|||.||.::.||:.|
  Rat   109 HEVKDNYIPVIKRASNSVPVIIAAVGTRQNEELPCTCPLCTSDRGSCVTTTEGIQLAKELGA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 33/127 (26%)
RHO 38..202 CDD:197554 33/127 (26%)
Rhobtb3NP_001101115.1 P-loop_NTPase 34..174 CDD:304359 33/127 (26%)
BTB 413..515 CDD:279045
BTB 421..518 CDD:197585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24072
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.