DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RHOD

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_055393.1 Gene:RHOD / 29984 HGNCID:670 Length:210 Species:Homo sapiens


Alignment Length:182 Identity:73/182 - (40%)
Similarity:110/182 - (60%) Gaps:17/182 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGMTANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTL 87
            ||:        |.:|:.:||||..|||.:|:.:....|||.|.||||:.:..|:.|..:..:|.:
Human    13 PGV--------RSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHI 69

  Fly    88 WDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR 152
            ||||||:||:|||||.||..:..|||:.::|..||:|:.::|:||:.||...||:::||.|.|||
Human    70 WDTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLR 134

  Fly   153 IP---------NSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEA 195
            ..         |..:.||...|::|.:.:.|...:||||:...|:..||:||
Human   135 KDKSLVNKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 70/169 (41%)
RHO 38..202 CDD:197554 69/167 (41%)
RHODNP_055393.1 Rho4_like 16..210 CDD:206704 71/171 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.