DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and RSA-14-44

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_872611.2 Gene:RSA-14-44 / 297173 RGDID:735071 Length:193 Species:Rattus norvegicus


Alignment Length:184 Identity:85/184 - (46%)
Similarity:122/184 - (66%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLRP 101
            |:.|||||..||||:||.:::::||:.|:||||:|:..:|.||.:...|.||||||||||:||||
  Rat     7 KLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRP 71

  Fly   102 LSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR---------IPNSE 157
            ||||.|:..|:|:||.:..||.|:..||.||::||..:||::|||:|.|||         ....:
  Rat    72 LSYPDTDVLLICFSIGNPDSFGNIPHKWIPEVKHFCPNVPIILVGSKKDLRNDLNTIQELAKRKQ 136

  Fly   158 KFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPKTTSKQSC 211
            :.|..::|:.:...|.||..||||||.|..:::|||:|.||..:..:...|..|
  Rat   137 EPVKPEQGRDLANSIGAFEYVECSAKTKDGVRKVFEKATRAALQTNRVKKKTGC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 81/169 (48%)
RHO 38..202 CDD:197554 82/172 (48%)
RSA-14-44NP_872611.2 RhoA_like 5..179 CDD:206662 83/171 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.