DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rhov

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:XP_011237767.1 Gene:Rhov / 228543 MGIID:2444227 Length:281 Species:Mus musculus


Alignment Length:209 Identity:79/209 - (37%)
Similarity:119/209 - (56%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGMTANITKSPR--------PLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVD 79
            |.:.|: |..||        .:|..:||||.|||:.::::||.|.:|..|.||..|..:..:.||
Mouse    57 PPLPAS-TPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPARYRPTALDTFSVQVLVD 120

  Fly    80 DRDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVL 144
            .....:.|||||||||::|||.|.||.|:.||.|:|:...:||:|:..||.||||..:...||:|
Mouse   121 GAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLL 185

  Fly   145 VGTKLDLRIPNSEKFVTTQEGKK----------MRKEIHAFNLVECSAKKKQNLQQVFEEAV-RA 198
            |||:.|||...:......|.|::          :.::|.|...:||||..::||::||:.|: .|
Mouse   186 VGTQADLRDDVNVLIQLDQGGREGPVPQPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSA 250

  Fly   199 VERKPKTTSKQSCK 212
            :|.|.:...|.:.|
Mouse   251 IEHKARLEKKLNAK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 69/172 (40%)
RHO 38..202 CDD:197554 70/174 (40%)
RhovXP_011237767.1 Wrch_1 77..250 CDD:133330 69/172 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.