Sequence 1: | NP_001247003.1 | Gene: | RhoL / 41136 | FlyBaseID: | FBgn0014380 | Length: | 214 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766200.1 | Gene: | Rnd1 / 223881 | MGIID: | 2444878 | Length: | 232 | Species: | Mus musculus |
Alignment Length: | 228 | Identity: | 64/228 - (28%) |
---|---|---|---|
Similarity: | 112/228 - (49%) | Gaps: | 44/228 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 KSPRPL----KITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTA 91
Fly 92 GQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNS 156
Fly 157 ---------EKFVTTQEGKKMRKEIHAFNLVECSA-KKKQNLQQVFEEA---------------- 195
Fly 196 VRAVERK----P------KTTSK----QSCKIL 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoL | NP_001247003.1 | Rho | 36..198 | CDD:206641 | 54/191 (28%) |
RHO | 38..202 | CDD:197554 | 54/189 (29%) | ||
Rnd1 | NP_766200.1 | P-loop_NTPase | 1..232 | CDD:304359 | 63/226 (28%) |
RHO | 16..190 | CDD:197554 | 52/173 (30%) | ||
Effector region. /evidence=ECO:0000255 | 42..50 | 5/7 (71%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0393 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |