DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rnd1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_766200.1 Gene:Rnd1 / 223881 MGIID:2444878 Length:232 Species:Mus musculus


Alignment Length:228 Identity:64/228 - (28%)
Similarity:112/228 - (49%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KSPRPL----KITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTA 91
            ::|:|:    |:.:|||...|||.||....::.:||.|:||||:|:...:..:::...|:||||:
Mouse     5 RAPQPVVVRCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTS 69

  Fly    92 GQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNS 156
            |...|:.:|||.|..::..|||:.||...:.::...||..||..:.....|:|:|.|.|||...|
Mouse    70 GSPYYDNVRPLCYSDSDAVLLCFDISRPETMDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLS 134

  Fly   157 ---------EKFVTTQEGKKMRKEIHAFNLVECSA-KKKQNLQQVFEEA---------------- 195
                     :..::.::|..:.|::.|...:|.|| ..:.::..:|..|                
Mouse   135 TLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSETSIHSIFRTASMVCLNKSSPVPPKSP 199

  Fly   196 VRAVERK----P------KTTSK----QSCKIL 214
            ||::.::    |      .||.|    :||.|:
Mouse   200 VRSLSKRLLHLPSRSELISTTFKKEKAKSCSIM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 54/191 (28%)
RHO 38..202 CDD:197554 54/189 (29%)
Rnd1NP_766200.1 P-loop_NTPase 1..232 CDD:304359 63/226 (28%)
RHO 16..190 CDD:197554 52/173 (30%)
Effector region. /evidence=ECO:0000255 42..50 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.