DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and chw-1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_505686.1 Gene:chw-1 / 184848 WormBaseID:WBGene00009059 Length:207 Species:Caenorhabditis elegans


Alignment Length:175 Identity:67/175 - (38%)
Similarity:97/175 - (55%) Gaps:1/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLR 100
            ||...||:..||||.|:::||.|.:|..|:||.|||.:..:.||.:...|.|.|||||..::.||
 Worm    10 LKCIFVGNAAVGKTSMIVSYTTNVYPHNYVPTAFDNFSVVVLVDKKPIRLQLHDTAGQSSFDTLR 74

  Fly   101 PLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNSEKFVTTQEG 165
            ||.|...:.|::.||:....|||:|...|:||:...:....::||||:.|.|.......||...|
 Worm    75 PLCYTDADVFVIVYSVVDLQSFEDVSHHWYPEVTKRNPGTKLILVGTQADQRWQVRGNTVTQLRG 139

  Fly   166 KKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPKTTSKQS 210
            |.:...:.| ...||||..:.||:|:|:.|:.|.....|...|:|
 Worm   140 KALADRLGA-EFFECSALTQHNLKQMFDAAILAGLEGKKNREKRS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 63/161 (39%)
RHO 38..202 CDD:197554 62/163 (38%)
chw-1NP_505686.1 Wrch_1 10..172 CDD:133330 63/162 (39%)
RHO 12..174 CDD:197554 62/162 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.