DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and mig-2

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_509931.1 Gene:mig-2 / 181344 WormBaseID:WBGene00003239 Length:195 Species:Caenorhabditis elegans


Alignment Length:194 Identity:99/194 - (51%)
Similarity:130/194 - (67%) Gaps:12/194 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SP-RPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQED 95
            || |.:|..:||||.||||||||:||.:.||.:|:||||||::..:::|....||.|||||||||
 Worm     3 SPSRQIKCVVVGDGTVGKTCMLISYTTDSFPVQYVPTVFDNYSAQMSLDGNVVNLGLWDTAGQED 67

  Fly    96 YERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLRIPNSEKF- 159
            |:||||||||.|:.|:||:|:.|..||:||.|||.||||......||:||||||||| ..:|.. 
 Worm    68 YDRLRPLSYPQTDVFILCFSVVSPVSFDNVASKWIPEIRQHCPDAPVILVGTKLDLR-DEAEPMR 131

  Fly   160 ---------VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAVERKPKTTSKQSCKIL 214
                     ::..:|.||.::|.|...:||||..:|.|.||||:|||::........|:||.|:
 Worm   132 ALQAEGKSPISKTQGMKMAQKIKAVKYLECSALTQQGLTQVFEDAVRSILHPKPQKKKKSCNIM 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 91/171 (53%)
RHO 38..202 CDD:197554 91/173 (53%)
mig-2NP_509931.1 Rho 8..178 CDD:206641 90/170 (53%)
RHO 10..183 CDD:197554 91/173 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.