DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and miro-1

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_500620.1 Gene:miro-1 / 177238 WormBaseID:WBGene00019544 Length:625 Species:Caenorhabditis elegans


Alignment Length:167 Identity:43/167 - (25%)
Similarity:82/167 - (49%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQEDYERLR 100
            ::|.::||...|||.::::...:|:.:. :|...|.......|...:...::.|.:.:|:.|...
 Worm    10 VRIVLIGDEGCGKTSLVMSLLEDEWVDA-VPRRLDRVLIPADVTPENVTTSIVDLSIKEEDENWI 73

  Fly   101 PLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRH-FSAH--VPVVLVGTKLDLRIPNSEKFVTT 162
            .......|...:.||::..::.:.:::||.|.||. |..:  .||:|||.|.|....|::|.:..
 Worm    74 VSEIRQANVICVVYSVTDESTVDGIQTKWLPLIRQSFGEYHETPVILVGNKSDGTANNTDKILPI 138

  Fly   163 QEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAVRAV 199
            .|.   ..|:.  ..|||||:..:|:.::|..|.:||
 Worm   139 MEA---NTEVE--TCVECSARTMKNVSEIFYYAQKAV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 41/164 (25%)
RHO 38..202 CDD:197554 43/165 (26%)
miro-1NP_500620.1 Miro1 9..173 CDD:206680 43/167 (26%)
Ras 11..171 CDD:278499 43/166 (26%)
EF_assoc_2 225..306 CDD:285547
EF_assoc_1 352..417 CDD:285546
Miro2 423..592 CDD:206679
Gem1 425..608 CDD:224025
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1464
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.