DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and Rhod

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_031511.1 Gene:Rhod / 11854 MGIID:108446 Length:210 Species:Mus musculus


Alignment Length:174 Identity:70/174 - (40%)
Similarity:109/174 - (62%) Gaps:9/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAVDDRDYNLTLWDTAGQED 95
            :|...:|:.:||||..|||.:::.:.:..|||.|.||||:.:...:.:..:..:|.:||||||:|
Mouse    13 QSGHSVKVVLVGDGGCGKTSLMMVFAKGAFPESYSPTVFERYNATLQMKGKPVHLQIWDTAGQDD 77

  Fly    96 YERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVVLVGTKLDLR-----IPN 155
            |:|||||.||..|..|||:.:::..||:||.::|:||:.||...||:::||.|:|||     :.|
Mouse    78 YDRLRPLFYPDANVLLLCFDVTNPNSFDNVSNRWYPEVTHFCKGVPIIVVGCKIDLRKDKVLVNN 142

  Fly   156 SEKF----VTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEA 195
            ..|.    ||...|..|.:.:.|...:||||:...|::.||:||
Mouse   143 LRKKRLEPVTYHRGHDMARSVGAVAYLECSARLHDNVEAVFQEA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 69/169 (41%)
RHO 38..202 CDD:197554 68/167 (41%)
RhodNP_031511.1 Rho4_like 17..208 CDD:206704 69/170 (41%)
RHO 20..192 CDD:197554 68/167 (41%)
Effector region. /evidence=ECO:0000255 46..54 5/7 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1166960at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.