DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and rhov

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001122131.1 Gene:rhov / 100038217 XenbaseID:XB-GENE-489435 Length:240 Species:Xenopus tropicalis


Alignment Length:213 Identity:81/213 - (38%)
Similarity:126/213 - (59%) Gaps:17/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DERGKKPGMTANITK-SPRP------LKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHAC 74
            |::...|.::..:.| :.||      :|..:||||.||||.::|:||.|.:|.||.||..|..:.
 Frog    11 DQKRLSPQLSELLCKQNSRPNSQELGIKCVLVGDGAVGKTSLVISYTINGYPTEYQPTALDTFSV 75

  Fly    75 NIAVDDRDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAH 139
            .:.||.....:.|.|||||||::.||.|.|..|:.||:|:|:.:.:||:||..||.||||..|.|
 Frog    76 QVLVDGAPVRIQLCDTAGQEDFDHLRSLCYAETDVFLVCFSVVNPSSFQNVTEKWIPEIRTHSPH 140

  Fly   140 VPVVLVGTKLDLR--------IPNSE-KFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEA 195
            .|:|||||:.|||        :..|. |.|:..:.:.:.::|.|...:||||..::||::||:.:
 Frog   141 TPIVLVGTQADLRDDVNVLINLSRSHVKPVSESQAQAVAQKIRAQTYIECSALTQKNLKEVFDAS 205

  Fly   196 V-RAVERKPKTTSKQSCK 212
            : .|::.|.:...|.:.|
 Frog   206 ILSAIKHKARLEKKLTSK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 72/171 (42%)
RHO 38..202 CDD:197554 72/173 (42%)
rhovNP_001122131.1 Wrch_1 37..209 CDD:133330 72/171 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.