DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoL and rhov

DIOPT Version :9

Sequence 1:NP_001247003.1 Gene:RhoL / 41136 FlyBaseID:FBgn0014380 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001012250.1 Gene:rhov / 100005849 ZFINID:ZDB-GENE-031002-10 Length:235 Species:Danio rerio


Alignment Length:222 Identity:77/222 - (34%)
Similarity:117/222 - (52%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LNKDERGKKPGMTANITKSPRPLKITIVGDGMVGKTCMLITYTRNEFPEEYIPTVFDNHACNIAV 78
            |.:||...:|.::.           .:||||.||||.|:::||.|.:|.:|..|.||..:..:.|
Zfish    19 LEQDEELLEPAISC-----------MLVGDGAVGKTSMIVSYTTNGYPTDYKQTAFDVFSGQVQV 72

  Fly    79 DDRDYNLTLWDTAGQEDYERLRPLSYPSTNCFLLCYSISSRTSFENVKSKWWPEIRHFSAHVPVV 143
            |.....:.|.||||||:::..|.|||..|:.||||:|:.:.|||:|:..||.||||..:...|::
Zfish    73 DGTPVRIQLMDTAGQEEFDEFRSLSYAHTDVFLLCFSVVNPTSFQNITKKWIPEIRECNPSSPII 137

  Fly   144 LVGTKLDLRIP---------NSEKFVTTQEGKKMRKEIHAFNLVECSAKKKQNLQQVFEEAV--- 196
            ||||:.||.:.         ...|.|.:...:.:.::|.|...|||||..::||::.|:.|:   
Zfish   138 LVGTQSDLVLDVNVLIDLDRYKVKPVCSSRARSLSEKIRAAEYVECSALTQKNLKEAFDAAIFAA 202

  Fly   197 -----------RAVERKPKTTSKQSCK 212
                       |..:|:.|..||.|.|
Zfish   203 IKHKARKAKKRRLSDRRTKAFSKCSWK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoLNP_001247003.1 Rho 36..198 CDD:206641 66/184 (36%)
RHO 38..202 CDD:197554 67/186 (36%)
rhovNP_001012250.1 Wrch_1 30..193 CDD:133330 64/173 (37%)
RHO 32..193 CDD:197554 64/171 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.