DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phu and AgaP_AGAP012589

DIOPT Version :9

Sequence 1:NP_649897.4 Gene:phu / 41135 FlyBaseID:FBgn0043791 Length:546 Species:Drosophila melanogaster
Sequence 2:XP_306016.2 Gene:AgaP_AGAP012589 / 1267459 VectorBaseID:AGAP012589 Length:131 Species:Anopheles gambiae


Alignment Length:92 Identity:24/92 - (26%)
Similarity:37/92 - (40%) Gaps:38/92 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GESSHDAERRMHPVFSLMGTGSNPIGGGRYKRAMPQIVFDAVRSEERYAEYWQGLAAQTLDQQLE 82
            |..:|..::|:             :..|.|               |:.|:||      .:..||:
Mosquito    74 GNEAHHRQKRL-------------VSAGEY---------------EKTAQYW------NIGAQLK 104

  Fly    83 SKLRL----NTQLARNVMLFIGDGMSI 105
            .|..|    |..:|:||:.|:||||||
Mosquito   105 LKEHLMRQPNRNIAKNVVFFLGDGMSI 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phuNP_649897.4 PhoA 71..524 CDD:224699 15/39 (38%)
alkPPc 93..530 CDD:214515 9/13 (69%)
AgaP_AGAP012589XP_306016.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19548at7147
OrthoFinder 1 1.000 - - FOG0000192
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.