Sequence 1: | NP_649897.4 | Gene: | phu / 41135 | FlyBaseID: | FBgn0043791 | Length: | 546 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012813827.1 | Gene: | arnt2 / 100101693 | XenbaseID: | XB-GENE-487404 | Length: | 723 | Species: | Xenopus tropicalis |
Alignment Length: | 276 | Identity: | 61/276 - (22%) |
---|---|---|---|
Similarity: | 99/276 - (35%) | Gaps: | 91/276 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 AERRMHPVFSLM----------GTGSNPIGGGRYKRAMPQIVFDAVRSEERYAEYWQGLAAQTLD 78
Fly 79 QQLESKLRLNTQ-----------------LARNVMLFIG---------DGMSIPTIT----AGRV 113
Fly 114 YLGG----EEKQFAF-----EQFPY-VGLSKTYCANMQV-------ADSACTATAY--LGGVKAN 159
Fly 160 YGTIGVSAAVQFKDCQAQAQAAHHVSSIAAWAQKQGMATGLVTTTSVTHASPAGVYAHLANRNWE 224
Fly 225 NDAEVVGD----NGDP 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
phu | NP_649897.4 | PhoA | 71..524 | CDD:224699 | 46/219 (21%) |
alkPPc | 93..530 | CDD:214515 | 41/180 (23%) | ||
arnt2 | XP_012813827.1 | HLH | 72..124 | CDD:278439 | |
PAS | 144..250 | CDD:279347 | |||
PAS | 147..206 | CDD:214512 | |||
PAS_11 | 343..443 | CDD:291273 | |||
PAS | 343..439 | CDD:238075 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1785 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |