DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phu and arnt2

DIOPT Version :9

Sequence 1:NP_649897.4 Gene:phu / 41135 FlyBaseID:FBgn0043791 Length:546 Species:Drosophila melanogaster
Sequence 2:XP_012813827.1 Gene:arnt2 / 100101693 XenbaseID:XB-GENE-487404 Length:723 Species:Xenopus tropicalis


Alignment Length:276 Identity:61/276 - (22%)
Similarity:99/276 - (35%) Gaps:91/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AERRMHPVFSLM----------GTGSNPIGGGRYKRAMPQIVFDAVRSEERYAEYWQGLAAQTLD 78
            ||..:||..||.          ...:|...||:.....|..:|...| :.|:||.:.|:.|.  :
 Frog   453 AELEVHPRDSLSSYDLSQVPVPNLAANVHEGGKSVVDKPDPIFSQDR-DPRFAEMFAGITAS--E 514

  Fly    79 QQLESKLRLNTQ-----------------LARNVMLFIG---------DGMSIPTIT----AGRV 113
            :::.|.....||                 .:.:|:...|         .|.::..|:    ||:|
 Frog   515 KKMLSASGSGTQQLYSTGSPFQPGHSGKSFSSSVVHVTGVNEIQSPSATGQNLTQISRQMNAGQV 579

  Fly   114 YLGG----EEKQFAF-----EQFPY-VGLSKTYCANMQV-------ADSACTATAY--LGGVKAN 159
            :.|.    :.:|.|.     :..|: :|.|.||.::...       |.|:.:..||  |||..|.
 Frog   580 WTGSRPPFQGQQIASQTSKPQSSPFGIGTSHTYTSDPSTYSPLSSPATSSPSGNAYSSLGGRSAA 644

  Fly   160 YGTIGVSAAVQFKDCQAQAQAAHHVSSIAAWAQKQGMATGLVTTTSVTHASPAGVYAHLANRNWE 224
            :...|.|::      |.|.:|:.      .|:|.|.......::....|..||            
 Frog   645 FTETGQSSS------QFQGRASE------VWSQWQSQHHNQPSSEQHPHQQPA------------ 685

  Fly   225 NDAEVVGD----NGDP 236
             .|||..|    :|||
 Frog   686 -QAEVFQDMLPMSGDP 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phuNP_649897.4 PhoA 71..524 CDD:224699 46/219 (21%)
alkPPc 93..530 CDD:214515 41/180 (23%)
arnt2XP_012813827.1 HLH 72..124 CDD:278439
PAS 144..250 CDD:279347
PAS 147..206 CDD:214512
PAS_11 343..443 CDD:291273
PAS 343..439 CDD:238075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.