DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and CAM1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:52/235 - (22%)
Similarity:105/235 - (44%) Gaps:44/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPA-LQIDGHT 78
            |..||:.:|.. :|..|..  :|.:..|:|.:: ..:..||...::    |:::||| :...|:.
Yeast     3 QGTLYANFRIR-TWVPRGL--VKALKLDVKVVT-PDAAAEQFARDF----PLKKVPAFVGPKGYK 59

  Fly    79 LIESVAIMHYL----EETRPQRPLL--PQDVHKRAKVREIVEI----ICSGIQPLQNLIVLIHVG 133
            |.|::||.:||    ::.:.:..||  ..|::.:|::.....:    :|  || :.|.||.:..|
Yeast    60 LTEAMAINYYLVKLSQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLC--IQ-IANTIVPLKGG 121

  Fly   134 EEKKKEWAQHWITRGFRAVEKALSTSAGK-----YCVGDEISMADCCLVPQVFNARRFHVDL--- 190
            ....|:    .:.....||:|.:.....:     |...:.||:|| .:...:|.  |:...|   
Yeast   122 APYNKK----SVDSAMDAVDKIVDIFENRLKNYTYLATENISLAD-LVAASIFT--RYFESLFGT 179

  Fly   191 ---RPYPIILRIDRELESNPAFRAAHP----SNQPDCPPE 223
               ..:|.|:|....:.::|..:..:.    :::|..||:
Yeast   180 EWRAQHPAIVRWFNTVRASPFLKDEYKDFKFADKPLSPPQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 21/78 (27%)
maiA 17..221 CDD:273527 49/229 (21%)
GST_C_Zeta 104..217 CDD:198300 24/131 (18%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 21/76 (28%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 24/131 (18%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.