DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and URE2

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:248 Identity:53/248 - (21%)
Similarity:98/248 - (39%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QPI----LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPAL--- 72
            ||:    |:|:..:...::|.|.  |.|:.:....|.|..:.||....|:..|||..:||||   
Yeast   109 QPLEGYTLFSHRSAPNGFKVAIV--LSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDH 171

  Fly    73 QIDGHTLIESVAIM------HYLE-----------------------ETRPQRPLLPQDVHKR-- 106
            .:|..::.||.||:      :|.|                       :|....|::.|.:|.|  
Yeast   172 GMDNLSIWESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYF 236

  Fly   107 --AKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGK------- 162
              .|:...||.....::.:..::.:...  |:::.......|      |.|.:.|||.       
Yeast   237 HSQKIASAVERYTDEVRRVYGVVEMALA--ERREALVMELDT------ENAAAYSAGTTPMSQSR 293

  Fly   163 ------YCVGDEISMADCCLVPQVFNARRFHVDLR-PYPIILRIDRELESNPA 208
                  :.|||::::||...||......|..:::: .:|.:.:..:.:...||
Yeast   294 FFDYPVWLVGDKLTIADLAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRPA 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 25/86 (29%)
maiA 17..221 CDD:273527 51/246 (21%)
GST_C_Zeta 104..217 CDD:198300 23/123 (19%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 23/81 (28%)
GST_C_Ure2p 208..350 CDD:198326 26/147 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.