DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GTT1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:224 Identity:46/224 - (20%)
Similarity:94/224 - (41%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PILYSYWRS-SCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQI-DGHT 78
            ||:..:|.. |.::|:...::...:.|:|.|..  :....:...|.::::|:.:.|.|:: |..|
Yeast     4 PIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYK--RDANFRAPPELKKIHPLGRSPLLEVQDRET 66

  Fly    79 -----LIESVAIMHY-LEETRPQRPLLPQDVHKRAKVRE-------------IVEIICSGIQ--- 121
                 |.||..|..| |:.......|:.:|.....::..             ::|.|.|.::   
Yeast    67 GKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDSG 131

  Fly   122 -PLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCL-VP-QVFNA 183
             |.....:...|.::..:.::...:...|..||..:|.:.| |.|..::|.||..: .| |:...
Yeast   132 MPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNG-YLVDGKLSGADILMSFPLQMAFE 195

  Fly   184 RRFHVDLRPYPIILRIDRELESNPAFRAA 212
            |:|... ..||.|.:..:.:.|..::.|:
Yeast   196 RKFAAP-EDYPAISKWLKTITSEESYAAS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 19/81 (23%)
maiA 17..221 CDD:273527 45/223 (20%)
GST_C_Zeta 104..217 CDD:198300 24/128 (19%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 18/82 (22%)
GST_C_GTT1_like 93..218 CDD:198298 24/126 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.