DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and TEF4

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:44/198 - (22%)
Similarity:72/198 - (36%) Gaps:66/198 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DIKPISLIKSGGEQHCNEYREVNPMEQVPA-LQIDGHTLIESVAIMHYL----EETRPQRPLLPQ 101
            |:|.:.|.:|      :|:..:.|::|.|| |...|..|.|::||..||    .:.:.:..||..
Yeast    27 DVKIVDLEQS------SEFASLFPLKQAPAFLGPKGLKLTEALAIQFYLANQVADEKERARLLGS 85

  Fly   102 DVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVG 166
            ||.:::::.....:..|.:  :.|                   |.|.|.:.:..:     .|...
Yeast    86 DVIEKSQILRWASLANSDV--MSN-------------------IARPFLSFKGLI-----PYNKK 124

  Fly   167 DEISMADCCLV-----PQVFNARRFHVDLRPYPIILRIDRELES---------------NPAFRA 211
            |    .|.|.|     ..||:||     ||.|..:...:..|..               .|.:||
Yeast   125 D----VDACFVKIDNLAAVFDAR-----LRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRA 180

  Fly   212 AHP 214
            .||
Yeast   181 KHP 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 17/52 (33%)
maiA 17..221 CDD:273527 44/198 (22%)
GST_C_Zeta 104..217 CDD:198300 23/131 (18%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 17/50 (34%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 23/130 (18%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.