DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and AT1G57720

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_176084.1 Gene:AT1G57720 / 842147 AraportID:AT1G57720 Length:413 Species:Arabidopsis thaliana


Alignment Length:182 Identity:35/182 - (19%)
Similarity:76/182 - (41%) Gaps:20/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EYREVNPMEQVPALQIDGHTLIESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPL 123
            |:.::||:.:||.|:.....:.||.||..|:........|....:.:.|.:.:.::.  |.::..
plant    44 EFLKMNPIGKVPVLETPEGPIFESNAIARYVSRKNGDNSLNGSSLIEYAHIEQWIDF--SSLEID 106

  Fly   124 QNLIVLI--HVG----EEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQV-- 180
            .|::...  .:|    ....:|.|...:.||..|:...|:::.  :.||..:::||...:..:  
plant   107 ANMLKWFAPRMGYAPFSAPAEEAAISALKRGLEALNTHLASNT--FLVGHSVTLADIVTICNLNL 169

  Fly   181 ----FNARRFHVDLRPYPIILRIDRELESNPAF-RAAHPSNQPDCPPELPNK 227
                ...::|   ...:|.:.|....:.:.|.| :....:.|.:..|.:|.|
plant   170 GFATVMTKKF---TSAFPHVERYFWTMVNQPEFKKVLGDAKQTEAVPPVPTK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 32/174 (18%)
AT1G57720NP_176084.1 GST_N_EF1Bgamma 6..77 CDD:239342 11/32 (34%)
GST_C_EF1Bgamma_like 90..210 CDD:198290 20/126 (16%)
EF1G 255..360 CDD:459888
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.