DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GSTF4

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:68 Identity:20/68 - (29%)
Similarity:30/68 - (44%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEETR 93
            ||...::.|.:.|:  ||::....||.....:..:||..|||..:.....|.||.||..|:....
plant    50 RVLAVLHEKRLSYE--PITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQYIAYVH 112

  Fly    94 PQR 96
            ..|
plant   113 SSR 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 20/68 (29%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 19/60 (32%)
GST_C_Phi 126..243 CDD:198296
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.