DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:127 Identity:30/127 - (23%)
Similarity:55/127 - (43%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PNASSSDIQP----ILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYRE----- 62
            |.|:|....|    :||.:.:|..|.:||:.:..|.:..:.:.:||.:|       |::|     
Human    34 PEAASPAHWPRESLVLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQS-------EHKEPWFMR 91

  Fly    63 VNPMEQVPALQIDGHTLIESVAIMHYLEET------------RPQRPLLPQDVHKRAKVREI 112
            :|..|:||.:....:.:.:...|:.|:|.|            .|.:||.....|..|.:.|:
Human    92 LNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGGGRGRCPSGFPAQPLAVPTEHVVALMPEV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 19/82 (23%)
maiA 17..221 CDD:273527 26/113 (23%)
GST_C_Zeta 104..217 CDD:198300 3/9 (33%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 26/114 (23%)
GST_N_GDAP1 47..119 CDD:239350 18/78 (23%)
GST_C_GDAP1L1 220..330 CDD:198335
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.