DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and gdap1l1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001072239.1 Gene:gdap1l1 / 779687 XenbaseID:XB-GENE-950543 Length:364 Species:Xenopus tropicalis


Alignment Length:113 Identity:31/113 - (27%)
Similarity:54/113 - (47%) Gaps:25/113 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYRE-----VNPMEQVPALQIDG 76
            :||.:.:|..|.::|:.:..|..|.|.:.:||       ...|::|     :|..|:||.: |.|
 Frog    46 VLYHWTQSFSSQKIRLVIAEKGFPCDERDVSL-------PLTEHKEPWFMRLNLGEEVPVV-IHG 102

  Fly    77 HTLIESV-AIMHYLE-----ETRPQRPLLPQD---VHKRA-KVREIVE 114
            ..:|... .|:.|:|     |..|:  |:|:.   .|.|. :.|||::
 Frog   103 DNIISDYNQIIDYIENNFVGELIPK--LIPETETIFHSRVLQYREILD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 21/78 (27%)
maiA 17..221 CDD:273527 31/113 (27%)
GST_C_Zeta 104..217 CDD:198300 5/12 (42%)
gdap1l1NP_001072239.1 Thioredoxin_like 45..117 CDD:381987 21/78 (27%)
GST_C_family 198..308 CDD:383119
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.