DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstD10

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_652713.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:197 Identity:45/197 - (22%)
Similarity:79/197 - (40%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YWRSSCSWRVRIAMNLKEIPYDIKPISLIKS-GGEQHCNEYREVNPMEQVPALQIDGHTLIESVA 84
            |:|...:....:.|..|.:..:....::|.: ..||...||.::||...:|.|...|..|.||.|
  Fly     4 YYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWESRA 68

  Fly    85 IMHYL-EETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITR- 147
            ||.|| |:......|.|:||.|:|.:.:.:......:.                |.:::::..: 
  Fly    69 IMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLY----------------KSFSEYYYPQI 117

  Fly   148 ---------GFRAVEKA---LST--SAGKYCVGDEISMADCCLVPQV--FNARRFHVDLRPYPII 196
                     .::.:|.|   |:|  ....|..|.:.|:||...:..|  |:...|  |.:.|..:
  Fly   118 FLKKPANEENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGF--DFKRYANV 180

  Fly   197 LR 198
            .|
  Fly   181 AR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 45/197 (23%)
GstD10NP_652713.1 GST_N_Delta_Epsilon 1..75 CDD:239343 22/70 (31%)
GST_C_Delta_Epsilon 89..205 CDD:198287 18/112 (16%)

Return to query results.
Submit another query.