DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and eef1e1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:216 Identity:44/216 - (20%)
Similarity:74/216 - (34%) Gaps:80/216 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQ-IDGHTLIESVAIMHYL--EETRPQ 95
            |.|:|:.      ||.:..|.:..|:| .....::||.|| .:|..|...|.|..:|  |..||:
Zfish     1 MALRELN------SLERFLGLKKANKY-STQGGKKVPVLQNNNGPALTGLVTIACHLVKEAKRPE 58

  Fly    96 RPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITR-------GFRAVE 153
              ||..|..:||.|                            ::|.:|.||:       ..:.:.
Zfish    59 --LLGDDAEQRAVV----------------------------QQWLEHRITKLDNCSKEEVKVIL 93

  Fly   154 KALS--TSAGKYCVGDEISMADCCLVPQV---------------FNARRFHVDLRPYP------- 194
            |.|:  .....|..|:..::||..:...:               .|..|:...::.||       
Zfish    94 KDLNRYLEDKVYLAGNVFTLADILMYYGIHHIIVELAIQEKECYLNVSRWFDHIQHYPGIRHHLP 158

  Fly   195 --IILRIDRELESNPAFRAAH 213
              ::||       |..:.:.|
Zfish   159 PVVVLR-------NRVYPSGH 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 17/58 (29%)
maiA 17..221 CDD:273527 44/216 (20%)
GST_C_Zeta 104..217 CDD:198300 21/143 (15%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 17/124 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.