Sequence 1: | NP_649895.1 | Gene: | GstZ2 / 41133 | FlyBaseID: | FBgn0037697 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314691.1 | Gene: | gstt1a / 563972 | ZFINID: | ZDB-GENE-031001-13 | Length: | 242 | Species: | Danio rerio |
Alignment Length: | 212 | Identity: | 49/212 - (23%) |
---|---|---|---|
Similarity: | 86/212 - (40%) | Gaps: | 65/212 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 VRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYL--EET 92
Fly 93 RPQRPLLPQDVHKRAKVREIVE-------------IICSGIQP---------------LQNLIVL 129
Fly 130 IHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYP 194
Fly 195 IILRIDRELESNPAFRA 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstZ2 | NP_649895.1 | GST_N_Zeta | 16..90 | CDD:239340 | 23/61 (38%) |
maiA | 17..221 | CDD:273527 | 49/212 (23%) | ||
GST_C_Zeta | 104..217 | CDD:198300 | 23/136 (17%) | ||
gstt1a | NP_001314691.1 | GstA | 3..199 | CDD:223698 | 49/212 (23%) |
GST_N_Theta | 3..78 | CDD:239348 | 23/62 (37%) | ||
GST_C_Theta | 91..217 | CDD:198292 | 23/135 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |