DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:243 Identity:64/243 - (26%)
Similarity:101/243 - (41%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSSDIQPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQI 74
            |||::  .||....|.....|.|......||::...:.|:|: ||....|:.:|:.:.:||||:.
 Frog     2 SSSEL--TLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKA-GEHLTQEFGKVSVLHKVPALKD 63

  Fly    75 DGHTLIESVAIMHYL-EETRPQRPLLPQDVHKRAKVREIVEIICSGIQP----------LQNLIV 128
            ...|:.||.|::.|| .:.:......|.|:.|||:|.|.:....:..:|          :...|:
 Frog    64 GNFTMAESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTIL 128

  Fly   129 LIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDL--- 190
            ...|..||.......::|......||.|...  .:..|||||:||...:.::.......|::   
 Frog   129 GKEVPSEKMNAVMAEFVTTMNNFEEKFLGNK--PFIAGDEISVADLVAIVEIMQVIASGVNVFEE 191

  Fly   191 RP------YPIILRIDRELESNPAFRAAHP-----SNQ---PDCPPEL 224
            ||      ..::..:..||     |..||.     |.|   |. ||||
 Frog   192 RPKLGSWKQRLVEAVGEEL-----FLEAHEWILSFSKQKFDPP-PPEL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 23/74 (31%)
maiA 17..221 CDD:273527 57/231 (25%)
GST_C_Zeta 104..217 CDD:198300 30/136 (22%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 23/78 (29%)
GST_C_Theta 95..221 CDD:198292 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.