DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstD8

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:185 Identity:47/185 - (25%)
Similarity:79/185 - (42%) Gaps:13/185 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YWRSSCSWRVR-IAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVA 84
            ::...||...| :.|..|.:..|:....|....|||...|:.::||...:|.|..||.::.||.|
  Fly     3 FYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRA 67

  Fly    85 IMHYL-EETRPQRPLLPQDVHKRAKVR-----EIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQH 143
            |:.|| |:......|.|.|..|:|.|.     ::..:..|.::.:...|...|..:.:    |..
  Fly    68 ILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNHPADPE----AMQ 128

  Fly   144 WITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILR 198
            .:...|..::..|...  :|..||.:::||..|:..|........|:..||.:.|
  Fly   129 KVDSAFGHLDTFLEDQ--EYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVAR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 23/70 (33%)
maiA 17..221 CDD:273527 47/185 (25%)
GST_C_Zeta 104..217 CDD:198300 20/100 (20%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 47/185 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 23/70 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/100 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.