DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstD4

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_524913.1 Gene:GstD4 / 48337 FlyBaseID:FBgn0010040 Length:215 Species:Drosophila melanogaster


Alignment Length:186 Identity:42/186 - (22%)
Similarity:72/186 - (38%) Gaps:16/186 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAI 85
            |:....|....|.|..|.:..::....|..:.||....|:.::||...:|.|..:|..:.||.||
  Fly     4 YYSPRSSGSRTIIMVAKALGLELNKKQLRITEGEHLKPEFLKLNPQHTIPTLVDNGFAIWESRAI 68

  Fly    86 MHYL-EETRPQRPLLPQDVHKRAKVREIVEIICSGIQP--LQNLIVLIHVGEEKKKEWAQHWITR 147
            ..|| |:......|.|.|..|||.:.:.:......:..  ::.....|..|:....|        
  Fly    69 AVYLVEKYGKDDSLFPNDPQKRALINQRLYFDMGTLHDSFMKYYYPFIRTGQLGNAE-------- 125

  Fly   148 GFRAVEKA-----LSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILR 198
            .::.||.|     :......|..|.::::||..::..|........|:..||.:.|
  Fly   126 NYKKVEAAFEFLDIFLEGQDYVAGSQLTVADIAILSSVSTFEVVEFDISKYPNVAR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 20/69 (29%)
maiA 17..221 CDD:273527 42/186 (23%)
GST_C_Zeta 104..217 CDD:198300 18/102 (18%)
GstD4NP_524913.1 PRK10542 1..184 CDD:182533 42/186 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/69 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460376
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.