DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstD3

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:167 Identity:43/167 - (25%)
Similarity:77/167 - (46%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYL-EETRPQRPLLPQD 102
            :.::.|.|:.:|  |||...::.::||...:|.|..:|.|:.||.||:.|| |:......|.|:|
  Fly     8 LEFNKKIINTLK--GEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKD 70

  Fly   103 VHKRAKVREIVEIICSGIQP-LQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKA---LST--SAG 161
            :.|:|.:.:.:....:.:.| |.|...       |.....|......::.|::.   |:|  ...
  Fly    71 IQKQAVINQRLYFDMALMYPTLANYYY-------KAFTTGQFGSEEDYKKVQETFDFLNTFLEGQ 128

  Fly   162 KYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILR 198
            .|..||:.::||..::..|.|......|:..||.:.|
  Fly   129 DYVAGDQYTVADIAILANVSNFDVVGFDISKYPNVAR 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 18/51 (35%)
maiA 17..221 CDD:273527 43/167 (26%)
GST_C_Zeta 104..217 CDD:198300 21/101 (21%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 18/51 (35%)
GstA 6..173 CDD:223698 43/167 (26%)
GST_C_Delta_Epsilon 72..188 CDD:198287 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.