Sequence 1: | NP_649895.1 | Gene: | GstZ2 / 41133 | FlyBaseID: | FBgn0037697 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004981.2 | Gene: | MARS1 / 4141 | HGNCID: | 6898 | Length: | 900 | Species: | Homo sapiens |
Alignment Length: | 214 | Identity: | 44/214 - (20%) |
---|---|---|---|
Similarity: | 77/214 - (35%) | Gaps: | 63/214 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 LIKSGGEQHCNEYREVNPM---EQVPALQID-GHTLIESVAIMHYLEETRPQRPLLPQDVHKRAK 108
Fly 109 VREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMAD 173
Fly 174 CCL-------------VPQVFNARRFH-------------------------VDLRPYPIILRID 200
Fly 201 RELESNPAFRAAHPSNQPD 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstZ2 | NP_649895.1 | GST_N_Zeta | 16..90 | CDD:239340 | 16/45 (36%) |
maiA | 17..221 | CDD:273527 | 44/214 (21%) | ||
GST_C_Zeta | 104..217 | CDD:198300 | 25/150 (17%) | ||
MARS1 | NP_004981.2 | Thioredoxin_like | <27..68 | CDD:294274 | 15/43 (35%) |
GstA | <47..189 | CDD:223698 | 29/151 (19%) | ||
GST_C_MetRS_N | 77..179 | CDD:198340 | 18/103 (17%) | ||
PRK12268 | 264..819 | CDD:237029 | |||
MetRS_core | 265..633 | CDD:173907 | |||
'HIGH' region | 273..283 | ||||
'KMSKS' region | 593..597 | ||||
Anticodon_Ia_Met | 642..771 | CDD:153411 | |||
MetRS_RNA | 845..889 | CDD:238475 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |