Sequence 1: | NP_649895.1 | Gene: | GstZ2 / 41133 | FlyBaseID: | FBgn0037697 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014610.1 | Gene: | gfzf / 40858 | FlyBaseID: | FBgn0250732 | Length: | 1045 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 51/201 - (25%) |
---|---|---|---|
Similarity: | 83/201 - (41%) | Gaps: | 24/201 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 SSSDIQPI----LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVP 70
Fly 71 ALQIDGHTLIESVAIMHYL-EETRPQRPLLPQDVHKRAKVRE---------IVEIICSGIQPLQN 125
Fly 126 LIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDL 190
Fly 191 RPYPII 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstZ2 | NP_649895.1 | GST_N_Zeta | 16..90 | CDD:239340 | 27/78 (35%) |
maiA | 17..221 | CDD:273527 | 48/194 (25%) | ||
GST_C_Zeta | 104..217 | CDD:198300 | 16/102 (16%) | ||
gfzf | NP_001014610.1 | FLYWCH | 18..87 | CDD:282369 | |
FLYWCH | 162..229 | CDD:282369 | |||
FLYWCH | 365..432 | CDD:282369 | |||
FLYWCH | 597..663 | CDD:282369 | |||
Thioredoxin_like | 811..886 | CDD:294274 | 25/76 (33%) | ||
GstA | 812..1000 | CDD:223698 | 47/191 (25%) | ||
GST_C_Delta_Epsilon | 900..1017 | CDD:198287 | 16/101 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |