Sequence 1: | NP_649895.1 | Gene: | GstZ2 / 41133 | FlyBaseID: | FBgn0037697 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956815.2 | Gene: | gstt2 / 393493 | ZFINID: | ZDB-GENE-040426-1617 | Length: | 228 | Species: | Danio rerio |
Alignment Length: | 225 | Identity: | 60/225 - (26%) |
---|---|---|---|
Similarity: | 90/225 - (40%) | Gaps: | 72/225 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 VRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEETR- 93
Fly 94 -PQR--PLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRA---- 151
Fly 152 -----------------VEKALSTSAG-------------KYCVGDEISMAD---CCLVPQVFNA 183
Fly 184 RRFHVDLRPYPIILRIDRELESNPAFRAAH 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstZ2 | NP_649895.1 | GST_N_Zeta | 16..90 | CDD:239340 | 23/59 (39%) |
maiA | 17..221 | CDD:273527 | 60/225 (27%) | ||
GST_C_Zeta | 104..217 | CDD:198300 | 31/147 (21%) | ||
gstt2 | NP_956815.2 | GST_N_Theta | 7..82 | CDD:239348 | 24/62 (39%) |
GST_C_Theta | 95..220 | CDD:198292 | 31/146 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |