DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and gstt2

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:225 Identity:60/225 - (26%)
Similarity:90/225 - (40%) Gaps:72/225 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEETR- 93
            |.|.:...:||:.::.|::.|  |||...|:.::|||::||.|:.:|..|.||.||:.||..|. 
Zfish    21 VLIFLKHNKIPHTVEQIAIRK--GEQKTPEFTKLNPMQKVPVLEDNGFVLTESDAILKYLATTYK 83

  Fly    94 -PQR--PLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRA---- 151
             |..  |.||:   |||:|.|..                         .| .|..||...|    
Zfish    84 VPDHWYPKLPE---KRARVDEYT-------------------------AW-HHMNTRMHAATVFW 119

  Fly   152 -----------------VEKALSTSAG-------------KYCVGDEISMAD---CCLVPQVFNA 183
                             :|||||..:|             .:..||:||:||   .|.:.|..::
Zfish   120 QEVLLPLMTGQPANTAKLEKALSDLSGTLDKLENMFLKRQAFLCGDDISLADLLAICELMQPMSS 184

  Fly   184 RRFHVDLRPYPIILRIDRELESNPAFRAAH 213
            .|..:..||..:..|...:...:.:|..||
Zfish   185 GRDILKDRPKLLSWRSRVQSALSDSFDEAH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 23/59 (39%)
maiA 17..221 CDD:273527 60/225 (27%)
GST_C_Zeta 104..217 CDD:198300 31/147 (21%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 24/62 (39%)
GST_C_Theta 95..220 CDD:198292 31/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.