DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstO1

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:205 Identity:54/205 - (26%)
Similarity:91/205 - (44%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILYSYWRSSCSW--RVRIAMNLKEIPYDI-------KP--ISLIKSGGEQHCNEYREVNPMEQVP 70
            ||..|....|.:  ||.:.::.|:|||..       ||  .||:.|.              .:||
  Fly    21 ILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSS--------------TKVP 71

  Fly    71 ALQI---DGH-TLIESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIH 131
            ||::   .|: .||||:.|..||:|..|:.||.|:|:.|:|:.:.::|.....|.....|  |:|
  Fly    72 ALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYL--LLH 134

  Fly   132 VGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVP--QVFNA------RRFHV 188
            ...|:..: ..|:  .|....|:.|.....|:..||...|.|..:.|  :.|::      ::|.:
  Fly   135 DNPEQLVD-TDHY--AGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFEL 196

  Fly   189 DLRPYPIILR 198
            ....:|.:::
  Fly   197 SPERFPTLIK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 54/205 (26%)
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 26/87 (30%)
GST_C_Omega 109..234 CDD:198293 21/103 (20%)

Return to query results.
Submit another query.