DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstO1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:205 Identity:54/205 - (26%)
Similarity:91/205 - (44%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILYSYWRSSCSW--RVRIAMNLKEIPYDI-------KP--ISLIKSGGEQHCNEYREVNPMEQVP 70
            ||..|....|.:  ||.:.::.|:|||..       ||  .||:.|.              .:||
  Fly    21 ILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSS--------------TKVP 71

  Fly    71 ALQI---DGH-TLIESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIH 131
            ||::   .|: .||||:.|..||:|..|:.||.|:|:.|:|:.:.::|.....|.....|  |:|
  Fly    72 ALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYL--LLH 134

  Fly   132 VGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVP--QVFNA------RRFHV 188
            ...|:..: ..|:  .|....|:.|.....|:..||...|.|..:.|  :.|::      ::|.:
  Fly   135 DNPEQLVD-TDHY--AGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFEL 196

  Fly   189 DLRPYPIILR 198
            ....:|.:::
  Fly   197 SPERFPTLIK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 26/87 (30%)
maiA 17..221 CDD:273527 54/205 (26%)
GST_C_Zeta 104..217 CDD:198300 21/103 (20%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 26/87 (30%)
GstA 22..216 CDD:223698 53/204 (26%)
GST_C_Omega 109..234 CDD:198293 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.