DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and se

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:214 Identity:51/214 - (23%)
Similarity:92/214 - (42%) Gaps:43/214 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYSYWRSSCSWRVRIAMNLKEIPYDI-------KPISLIKSGGEQHCNEYREVNPMEQVPALQI- 74
            |||......:.||.:.::.|:|||..       ||..|:            |.||..:||||:| 
  Fly    24 LYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLL------------EKNPQGKVPALEIV 76

  Fly    75 ---DGHTLIESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEK 136
               ....|.||:.|..||:|..|.|||.|:|..|:.:.:.::|    ..:.:.........|.:.
  Fly    77 REPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIE----RFRAVLGAFFKASDGGDL 137

  Fly   137 KKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVP-----QVFNARR---FHVDLRPY 193
            :..|:      |....|:.|:....::..|::..:.|..:.|     ::...:|   ::.|...:
  Fly   138 EPFWS------GLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRF 196

  Fly   194 P-IILRIDRELESNPAFRA 211
            | :.|.::| ::.:||..|
  Fly   197 PQLTLWLER-MKRDPAVMA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 25/82 (30%)
maiA 17..221 CDD:273527 51/214 (24%)
GST_C_Zeta 104..217 CDD:198300 18/117 (15%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 25/82 (30%)
GstA 22..215 CDD:223698 51/214 (24%)
GST_C_Omega 109..229 CDD:198293 18/117 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.