DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstO3

DIOPT Version :10

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:208 Identity:54/208 - (25%)
Similarity:89/208 - (42%) Gaps:36/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYR-EVNPMEQVPALQIDGH---- 77
            |||......:.|..:.:|.|.:||....|:|.:.      .|:. ||:|:.:|||||:...    
  Fly    24 LYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEK------PEWLVEVSPLLKVPALQLVAEKGEP 82

  Fly    78 TLIESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQ 142
            :||||:.|..||::..|:.||||:|..|||:.:.::|...|......|::|   .|...:..|. 
  Fly    83 SLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINILV---QGTGLEDYWT- 143

  Fly   143 HWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQV---------------FNARRFHVDLRP 192
                 .....|:.|:.....|..|::....|..:.|..               ||..|| ..:..
  Fly   144 -----ALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRF-PKITK 202

  Fly   193 YPIILRIDRELES 205
            :..:|:.|..::|
  Fly   203 WIALLKADSVVQS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 maiA 17..221 CDD:273527 54/208 (26%)
GstO3NP_648234.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 25/76 (33%)
GST_C_Omega 109..230 CDD:198293 22/117 (19%)

Return to query results.
Submit another query.