DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstE12

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:244 Identity:60/244 - (24%)
Similarity:96/244 - (39%) Gaps:66/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGH-T 78
            :|.||....|..|..|.:......:..:::||:|:|  ||....|:.::||...:|.| |||. |
  Fly     3 KPALYYATLSPPSRAVLLTAKAIGLDLELRPINLLK--GEHLTPEFLKLNPQHTIPTL-IDGEAT 64

  Fly    79 LIESVAIMHYLEET--RPQRPLLPQDVHKRAKV---------------REIVEII-------CSG 119
            :|:|.||..||.|.  :.::.|.|:::.:||.|               |.:.|.|       || 
  Fly    65 IIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCS- 128

  Fly   120 IQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQV---- 180
               :..:..:       :|.|.   |..||...:        .|..|.::::||.|.|..|    
  Fly   129 ---IDKIAYI-------QKCWE---ILEGFLKDQ--------PYLCGSDLTIADFCAVATVTSVN 172

  Fly   181 -------FNARRFHVDLR-----PYPIILRIDRELESNPAFRAAHPSNQ 217
                   |...:.|..|:     ||...:..|...|....|:|....|:
  Fly   173 DTAPIDEFKFPKMHAWLKRLAELPYYQEVNGDGADELKSIFKAKLAENR 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 26/74 (35%)
maiA 17..221 CDD:273527 59/242 (24%)
GST_C_Zeta 104..217 CDD:198300 29/150 (19%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/75 (36%)
GstA 6..201 CDD:223698 54/219 (25%)
GST_C_Delta_Epsilon 92..210 CDD:198287 27/139 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460419
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.