DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstE11

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:203 Identity:47/203 - (23%)
Similarity:93/203 - (45%) Gaps:12/203 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTL 79
            :||||...||.....|.:......:..|::.:::  ..||....|:.::|....:|.|..:|..:
  Fly     4 KPILYYAPRSPPCRAVLLTAAALGLELDLRLVNV--KAGEHKSAEFLKLNAQHTIPVLDDNGTIV 66

  Fly    80 IESVAIMHYL-EETRPQ--RPLLPQDVHKRAKVREIVEIICSGIQPLQNLIV--LIHVGEEKKKE 139
            .:|..|..|| ::..|:  ..|.|:|..||..|...:...|..:.|....||  :|:.|..:...
  Fly    67 SDSHIICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPS 131

  Fly   140 WAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRP--YPIILRIDRE 202
            ....::.:.:..:|..|  :.|.|.|||::::||...:..|..|..| ..:.|  :|.:::..:.
  Fly   132 DRVAYLQKAYDGLEHCL--AEGDYLVGDKLTIADLSCIASVSTAEAF-APIEPDQFPRLVQWVKR 193

  Fly   203 LESNPAFR 210
            :::.|.::
  Fly   194 IQALPYYQ 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 19/74 (26%)
maiA 17..221 CDD:273527 46/201 (23%)
GST_C_Zeta 104..217 CDD:198300 24/111 (22%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 46/197 (23%)
GST_N_Delta_Epsilon 5..78 CDD:239343 19/74 (26%)
GST_C_Delta_Epsilon 94..211 CDD:198287 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460421
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.