DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstE6

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:191 Identity:50/191 - (26%)
Similarity:86/191 - (45%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYL-EETR 93
            |::.:....:.|:...:.::...  |...||.|.||...||.|:.|||.:.:|.||:.|| .:..
  Fly    18 VKLTLAALNLTYEYVNVDIVARA--QLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYA 80

  Fly    94 PQRPLLPQDVHKRAKVREIVE-----IICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVE 153
            ....|.|:|..|||.|.:.:.     :..:||:.:...:  :..|:.|..:.....|...:..||
  Fly    81 DSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSV--LFQGQTKVPKERYDAIIEIYDFVE 143

  Fly   154 KALSTSAGKYCVGDEISMADCCLVPQVFNARRF-HVDLRPYPIILRIDRELESNPAFRAAH 213
            ..|  ....|..|:::::||..||..|.:...| .:|...||.|....::||..|.:..|:
  Fly   144 TFL--KGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLPYYEEAN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 19/60 (32%)
maiA 17..221 CDD:273527 50/191 (26%)
GST_C_Zeta 104..217 CDD:198300 28/116 (24%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 48/183 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 19/60 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460417
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.