DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstE2

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:206 Identity:50/206 - (24%)
Similarity:89/206 - (43%) Gaps:27/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DIQPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGH 77
            ||.|.:     .:|...:| |:||   .|:.|.:.|:  .|:...:.:.:.||...||.|:.:|.
  Fly    11 DISPPV-----RACKLTLR-ALNL---DYEYKEMDLL--AGDHFKDAFLKKNPQHTVPLLEDNGA 64

  Fly    78 TLIESVAIMHYL-EETRPQRPLLPQDVHKRAKVREIVEIICSGI-QPLQNLIV------LIHVGE 134
            .:.:|.||:.|| ::......|.|:|:..||:|.:.:....|.: ..|:|:.:      :..|.:
  Fly    65 LIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYFLRQVSLVPK 129

  Fly   135 EKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMAD-CCLVPQVFNARRFHVDLRPYPIILR 198
            ||...     |...:..:|..|..:  .|..|.::::|| ||.......|....:|...||.:..
  Fly   130 EKVDN-----IKDAYGHLENFLGDN--PYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAA 187

  Fly   199 IDRELESNPAF 209
            ....|...|.:
  Fly   188 WFERLSKLPHY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 21/74 (28%)
maiA 17..221 CDD:273527 47/202 (23%)
GST_C_Zeta 104..217 CDD:198300 24/114 (21%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 49/202 (24%)
GST_N_Delta_Epsilon 5..78 CDD:239343 23/77 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460407
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.