DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstE14

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:184 Identity:49/184 - (26%)
Similarity:81/184 - (44%) Gaps:36/184 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SDIQPILYSYWRS----SCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPAL 72
            |..:||||...||    ||...::    |.:|..:::.::|.|  |||...::..:||...||.|
  Fly     2 SQPKPILYYDERSPPVRSCLMLIK----LLDIDVELRFVNLFK--GEQFQKDFLALNPQHSVPTL 60

  Fly    73 QIDGHTLIESVAIM-HYLEETRPQRPLLPQDVHKRAKVREIVEIICSGI-------------QPL 123
            ......|.:|.||: |..|:......|.||:..:|.||..::...||.:             |..
  Fly    61 VHGDLVLTDSHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGF 125

  Fly   124 QNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLV 177
            .|:.|..|   |:|       :|..:..:|:.|..|  .:..|.::::||..:|
  Fly   126 ANVDVAHH---ERK-------LTEAYIIMERYLENS--DFMAGPQLTLADLSIV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 25/78 (32%)
maiA 17..221 CDD:273527 47/179 (26%)
GST_C_Zeta 104..217 CDD:198300 19/87 (22%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 48/180 (27%)
GST_N_Delta_Epsilon 6..79 CDD:239343 25/78 (32%)
GST_C_Delta_Epsilon 94..209 CDD:198287 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.