DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstT1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:232 Identity:60/232 - (25%)
Similarity:109/232 - (46%) Gaps:58/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILYSY-WRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDG-HTL 79
            |.|.| :.|..|..:.|||.|.:.|::..|::|.|.  ||..:|||.:|..::|||: :|| ..|
  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQ--EQLTDEYRSINRFQKVPAI-VDGKFQL 66

  Fly    80 IESVAIMHYLEETRP-QRPLLPQDVHKRAKVREIVE-------IICS------------GIQPL- 123
            .|||:|:.||.:... ...|.|:.:.:||:|.|.:|       ::||            |:.|. 
  Fly    67 GESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAP 131

  Fly   124 --QNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNAR-- 184
              :::..||...|.......:.|:.:.|              .|||::::||      :|.:.  
  Fly   132 KPESVKKLIKDVESNLGLLERLWLEKDF--------------LVGDKLTVAD------IFGSSEI 176

  Fly   185 ------RFHVDLRPYPIILR-IDRELE-SNPAFRAAH 213
                  :::|:.:.:|.:.: ::|..: :||.:..||
  Fly   177 NQMKLCQYNVNEKQFPKVAKWMERVRDATNPYYDEAH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 30/74 (41%)
maiA 17..221 CDD:273527 60/232 (26%)
GST_C_Zeta 104..217 CDD:198300 27/142 (19%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 56/221 (25%)
GST_N_Theta 5..80 CDD:239348 31/77 (40%)
GST_C_Theta 93..218 CDD:198292 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460118
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.