DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstT3

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:232 Identity:60/232 - (25%)
Similarity:102/232 - (43%) Gaps:36/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TNLCPNASSSDIQPILYSY-WRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEY-REVNP 65
            |||..:|      ||.|.| ..|..|..:.|...|..:|::...::|  ..||....:: :|:|.
  Fly    37 TNLRMSA------PIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVAL--RNGEHLTEDFKKEINR 93

  Fly    66 MEQVPALQIDGHTLIESVAIMHYLE-ETRPQRPLLPQDVHKRAKVREIVE-------IICS---- 118
            .::||.:..:|:.|.|||||:.||. :.:....|.|:....:::|.|.:|       :.|:    
  Fly    94 FQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFR 158

  Fly   119 --GIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGK-YCVGDEISMADCCLVPQV 180
              .::||    :......|.|.|..:..:.|....||:.  ...|| :..|..:::||.....::
  Fly   159 TVWLEPL----LTGRTPSEAKIETFRMQMERNLDVVEEV--WLEGKDFLTGSSLTVADIFAACEI 217

  Fly   181 FNARRFHVDLR-PYPII---LRIDRELESNPAFRAAH 213
            ...|....|:| .||.|   |:..|: ..||.:..||
  Fly   218 EQTRMADYDVRIKYPKIRAWLKRVRQ-SCNPYYDVAH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 24/75 (32%)
maiA 17..221 CDD:273527 55/218 (25%)
GST_C_Zeta 104..217 CDD:198300 29/128 (23%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/77 (31%)
GstA 47..243 CDD:223698 49/203 (24%)
GST_C_Theta 135..259 CDD:198292 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460114
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.