DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and Clic

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:158 Identity:35/158 - (22%)
Similarity:66/158 - (41%) Gaps:23/158 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEETRP-QRPLL 99
            ||.|...:..:.:.|...:...| :...:|    |.|..:|..::|:..|..::.:..| ...|.
  Fly    56 LKTISLKVTTVDMQKPPPDFRTN-FEATHP----PILIDNGLAILENEKIERHIMKNIPGGYNLF 115

  Fly   100 PQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYC 164
            .||       :|:..:|       :||.|.:.:...||.|...:.:....|.:...||....::.
  Fly   116 VQD-------KEVATLI-------ENLYVKLKLMLVKKDEAKNNALLSHLRKINDHLSARNTRFL 166

  Fly   165 VGDEISMADCCLVPQVFNAR---RFHVD 189
            .||.:...||.|:|::.:.|   ::.||
  Fly   167 TGDTMCCFDCELMPRLQHIRVAGKYFVD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 11/53 (21%)
maiA 17..221 CDD:273527 35/158 (22%)
GST_C_Zeta 104..217 CDD:198300 20/89 (22%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 12/60 (20%)
O-ClC 21..231 CDD:129941 35/158 (22%)
GST_C_CLIC 118..232 CDD:198307 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.