DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GSTZ1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:210 Identity:125/210 - (59%)
Similarity:155/210 - (73%) Gaps:0/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTL 79
            :||||||:|||||||||||:.||.|.|:..||:|||.||:|...:::.:|||:|||.|:|||.|:
Human     6 KPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITI 70

  Fly    80 IESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHW 144
            .:|:||:.||||.||...|||||..|||.||.|.::|..||||||||.||..||||.:..|||:.
Human    71 HQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNA 135

  Fly   145 ITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNPAF 209
            ||.||.|:|:.|.::||.||||||::|||.||||||.||.||.|||.|||.|..|::.|....||
Human   136 ITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAF 200

  Fly   210 RAAHPSNQPDCPPEL 224
            :.:||..|||.|.||
Human   201 QVSHPCRQPDTPTEL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 44/73 (60%)
maiA 17..221 CDD:273527 121/203 (60%)
GST_C_Zeta 104..217 CDD:198300 65/112 (58%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 121/203 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143210
Domainoid 1 1.000 97 1.000 Domainoid score I7276
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 253 1.000 Inparanoid score I3208
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63171
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 1 1.000 - - FOG0002989
OrthoInspector 1 1.000 - - otm40913
orthoMCL 1 0.900 - - OOG6_103004
Panther 1 1.100 - - LDO PTHR42673
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1983
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.