DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and GstT2

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_724816.3 Gene:GstT2 / 246386 FlyBaseID:FBgn0050005 Length:228 Species:Drosophila melanogaster


Alignment Length:221 Identity:52/221 - (23%)
Similarity:93/221 - (42%) Gaps:52/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IQPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHT 78
            :.||....|         |.:.....|.:..||:|.|.  ||..:||:::|..::|||:......
  Fly    12 LSPIARGLW---------IGLKFSNSPVEYCPIALRKF--EQLTDEYKKINRFQKVPAIVGGDFH 65

  Fly    79 LIESVAIMHYL-EETRPQRPLLPQDVHKRAKVREIVE-------IICS------------GIQPL 123
            |.|::||:.|| ::.:....|.|:.:..||:|.|.:|       :.||            ||.|.
  Fly    66 LSETIAIIRYLADKGQFDEKLYPKTLENRARVDEFLEWQHLNIRLACSMYFRDAWLFPMNGIAPK 130

  Fly   124 ---QNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNAR- 184
               :.:..||...|.......:.|:...|              .||..::|||.....::...| 
  Fly   131 PKPEQIQALIEGVENNLGLLERLWLENDF--------------LVGKNLTMADILGSSEINQLRL 181

  Fly   185 -RFHVDLRPYPIILR-IDR-ELESNP 207
             ::.||.:.:|.::: ::| .:.:||
  Fly   182 CQYRVDEKKFPKVVKWLERVRVSANP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 23/74 (31%)
maiA 17..221 CDD:273527 51/218 (23%)
GST_C_Zeta 104..217 CDD:198300 27/130 (21%)
GstT2NP_724816.3 GST_N_Theta 5..80 CDD:239348 23/78 (29%)
GstA 7..202 CDD:223698 50/214 (23%)
GST_C_family 93..218 CDD:295467 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.