DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and Mars1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001165053.1 Gene:Mars1 / 216443 MGIID:1345633 Length:910 Species:Mus musculus


Alignment Length:212 Identity:47/212 - (22%)
Similarity:72/212 - (33%) Gaps:62/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LIKSGGEQHCNEYREVNPM---EQVPALQID-GHTLIESVAIMHYLEETRPQRPLLPQDVHKRAK 108
            ||.:.|.:.|     |.|.   .:||.||:| |:.|..:.||..|.        .|.....:...
Mouse    29 LISTVGPEEC-----VVPFLTRPKVPVLQLDSGNYLFSASAICRYF--------FLLCGWEQDDL 80

  Fly   109 VREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMAD 173
            ..:.:|...:.:||:.:..:...|.:.||.|.....:.|....::.:||.....:..||..|:||
Mouse    81 TNQWLEWEATELQPVLSAALHCLVVQGKKGEDILGPLRRVLTHIDHSLSRQNCPFLAGDTESLAD 145

  Fly   174 CCLVPQVFNARRFHVDLRPYPII---LRIDREL-----------ESNPAFRAA------------ 212
            ..|...:            ||::   ..:..||           ...|..|||            
Mouse   146 IVLWGAL------------YPLLQDPAYLPEELGALQSWFQTLSTQEPCQRAAETVLKQQGVLAL 198

  Fly   213 ------HPSNQPDCPPE 223
                  .|..||. |||
Mouse   199 RLYLQKQPQPQPP-PPE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 16/45 (36%)
maiA 17..221 CDD:273527 44/208 (21%)
GST_C_Zeta 104..217 CDD:198300 25/144 (17%)
Mars1NP_001165053.1 Thioredoxin_like 1..68 CDD:294274 15/43 (35%)
GstA <47..189 CDD:223698 35/161 (22%)
GST_C_MetRS_N 77..179 CDD:198340 20/113 (18%)
PRK12268 266..821 CDD:237029
MetRS_core 267..635 CDD:173907
'HIGH' region 275..285
'KMSKS' region 595..599
Anticodon_Ia_Met 644..773 CDD:153411
MetRS_RNA 855..899 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.