DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and eef1g

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio


Alignment Length:154 Identity:44/154 - (28%)
Similarity:70/154 - (45%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PMEQVPALQ-IDGHTLIESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIV 128
            |:.:|||.| .||..|.||.||.|||... ..|...||   ..|:|.:.|....|.:.|..:..|
Zfish    54 PLGKVPAYQGDDGFCLFESNAIAHYLSND-VLRGSTPQ---ASAQVLQWVSFADSEVIPPASAWV 114

  Fly   129 LIHVG----EEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVD 189
            ...:|    .::..|.|:..:.|....:.:.|:|..  :.||:.||:||..:|..:....:..::
Zfish   115 FPTLGIMQFNKQATEQAKEEVKRVLAVLNQHLNTRT--FLVGERISLADITVVCSLLWLYKQVLE 177

  Fly   190 L---RPYPIILRIDRELESNPAFR 210
            |   :|||.:.|......:.|.|:
Zfish   178 LAFRQPYPNVTRWFVTCVNQPQFK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 14/25 (56%)
maiA 17..221 CDD:273527 44/154 (29%)
GST_C_Zeta 104..217 CDD:198300 26/114 (23%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342 15/27 (56%)
maiA 5..201 CDD:273527 43/152 (28%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 26/113 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.