DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and gst-43

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:212 Identity:93/212 - (43%)
Similarity:135/212 - (63%) Gaps:8/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTL 79
            :|||||||||||:||||||:.||.|.|:.:||.|.....:.:. |:.:.||.::||.|.|:|.:|
 Worm     3 KPILYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNA-EFVKHNPAKKVPTLVINGLSL 66

  Fly    80 IESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKE----- 139
            .||:||:.||:|..|..|.||:::.||:..|.|...|.:.|||||  .:.||....:|:.     
 Worm    67 TESLAIIEYLDEAYPDPPFLPKELDKRSYSRAIALHIVASIQPLQ--AINIHKMLNEKEPGYGDF 129

  Fly   140 WAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELE 204
            |..|::.:||.|:|:.|...:|||||||::::||..|...::||:.:.||:..||.|.||:..|.
 Worm   130 WCNHFVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIYKVDMSKYPTITRINEILA 194

  Fly   205 SNPAFRAAHPSNQPDCP 221
            .:..|:.|||.||||.|
 Worm   195 EDFRFKLAHPDNQPDAP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 38/73 (52%)
maiA 17..221 CDD:273527 91/208 (44%)
GST_C_Zeta 104..217 CDD:198300 44/117 (38%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 38/73 (52%)
maiA 5..211 CDD:273527 91/208 (44%)
GST_C_Zeta 90..207 CDD:198300 44/118 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5260
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 198 1.000 Inparanoid score I2488
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63171
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 1 1.000 - - FOG0002989
OrthoInspector 1 1.000 - - mtm4732
orthoMCL 1 0.900 - - OOG6_103004
Panther 1 1.100 - - O PTHR42673
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1983
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.