DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstZ2 and gstz1

DIOPT Version :9

Sequence 1:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:210 Identity:132/210 - (62%)
Similarity:162/210 - (77%) Gaps:1/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 QPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTL 79
            :|:||.|:|||||||||||:..|.|.||.:.|:|:|.||.|..|||::||||:|||||.|||.||
 Frog     6 KPLLYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTL 70

  Fly    80 IESVAIMHYLEETRPQRPLLPQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHW 144
            .:|:||:.|||||||..||||:|..|||:||.|.:.|.|||||||||.||..:| |.|.|||:|:
 Frog    71 SQSLAIIEYLEETRPNPPLLPRDPKKRAQVRMISDQIASGIQPLQNLCVLQKIG-ETKLEWAKHF 134

  Fly   145 ITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNPAF 209
            |||||:|:||.|.|:||:||||||:::||.||||||.||.||.|||.|||.|:.|:..|....||
 Frog   135 ITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRFKVDLAPYPTIVGINESLLQLEAF 199

  Fly   210 RAAHPSNQPDCPPEL 224
            :.:|||.|||.|.||
 Frog   200 QVSHPSCQPDTPEEL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 46/73 (63%)
maiA 17..221 CDD:273527 128/203 (63%)
GST_C_Zeta 104..217 CDD:198300 69/112 (62%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 128/203 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6363
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I3034
OMA 1 1.010 - - QHG63171
OrthoDB 1 1.010 - - D1283865at2759
OrthoFinder 1 1.000 - - FOG0002989
OrthoInspector 1 1.000 - - otm48111
Panther 1 1.100 - - LDO PTHR42673
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1983
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.